Lineage for d5xt5c_ (5xt5 C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213792Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2213793Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2213808Family d.224.1.2: NifU/IscU domain [102928] (5 protein domains)
  6. 2213823Protein automated matches [254586] (5 species)
    not a true protein
  7. 2299979Species Bacillus subtilis [TaxId:224308] [343280] (1 PDB entry)
  8. 2300052Domain d5xt5c_: 5xt5 C: [343353]
    Other proteins in same PDB: d5xt5a1, d5xt5a2, d5xt5b_
    automated match to d1xjsa_
    complexed with plp, zn

Details for d5xt5c_

PDB Entry: 5xt5 (more details), 2.34 Å

PDB Description: sufs-sufu complex from bacillus subtilis
PDB Compounds: (C:) Zinc-dependent sulfurtransferase SufU

SCOPe Domain Sequences for d5xt5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xt5c_ d.224.1.2 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
nldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfegeg
csismasasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfpar
ikcatlswkalekgv

SCOPe Domain Coordinates for d5xt5c_:

Click to download the PDB-style file with coordinates for d5xt5c_.
(The format of our PDB-style files is described here.)

Timeline for d5xt5c_:

  • d5xt5c_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21