SCOPe 2.07: Domain d5wk3t2: 5wk3 T:113-218

Lineage for d5wk3t2 (5wk3 T:113-218)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d5wk3t2: 5wk3 T:113-218 [343291]
Other proteins in same PDB: d5wk3a_, d5wk3b_, d5wk3c_, d5wk3d_, d5wk3p1, d5wk3r1, d5wk3t1, d5wk3v1
automated match to d1dn0a2
complexed with gol

Details for d5wk3t2

PDB Entry: 5wk3 (more details), 1.9 Å

PDB Description: crystal structure of the complex between ccl17 and m116 fab

PDB Compounds: (T:) m116 light chain

SCOPe Domain Sequences for d5wk3t2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wk3t2 b.1.1.2 (T:113-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d5wk3t2:

Click to download the PDB-style file with coordinates for d5wk3t2.
(The format of our PDB-style files is described here.)

Timeline for d5wk3t2: