Lineage for d5osij_ (5osi J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604282Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 2604300Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 2604304Species Human (Homo sapiens) [TaxId:9606] [160872] (5 PDB entries)
  8. 2604312Domain d5osij_: 5osi J: [342815]
    automated match to d2r17a_
    complexed with edo, na

Details for d5osij_

PDB Entry: 5osi (more details), 2.52 Å

PDB Description: structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176)
PDB Compounds: (J:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5osij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5osij_ d.159.1.7 (J:) Vacuolar protein sorting 29, VPS29 {Human (Homo sapiens) [TaxId: 9606]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
kp

SCOPe Domain Coordinates for d5osij_:

Click to download the PDB-style file with coordinates for d5osij_.
(The format of our PDB-style files is described here.)

Timeline for d5osij_: