Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Choristoneura fumiferana [TaxId:7141] [342677] (4 PDB entries) |
Domain d6b04c_: 6b04 C: [342679] automated match to d4demf_ complexed with c6j, edo, mg |
PDB Entry: 6b04 (more details), 1.83 Å
SCOPe Domain Sequences for d6b04c_:
Sequence, based on SEQRES records: (download)
>d6b04c_ a.128.1.0 (C:) automated matches {Choristoneura fumiferana [TaxId: 7141]} sfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemlekpen iteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavndsslmf ssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerrqksdyslftierynai vkyktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygdesltg kmgtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelyaq eetrmyeslikqahglpselspalfvrlihmiykrnh
>d6b04c_ a.128.1.0 (C:) automated matches {Choristoneura fumiferana [TaxId: 7141]} sfedvlpsilntittnseltevpevanwlkkvleynlaggkkarglttlfayemlekpen iteetiylaktlgwcveilqgflvmlddimdgsttrrgvpcwyqlpevglaavndsslmf ssifyvlhahfadkkiytnlvelfneslmhtsigqhldvtmerksdyslftierynaivk yktayytyqlpvclgmllanisdpvlhqkaedmcleigkffqiqddyidcygdesltgkm gtdiqeakcswlavmalqrcsasqkivfttcygskepahierikelykqlqlpelyaqee trmyeslikqahglpselspalfvrlihmiykrnh
Timeline for d6b04c_: