SCOPe 2.06: Domain d5lbzb_: 5lbz B:

Lineage for d5lbzb_ (5lbz B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)

8. Domain d5lbzb_: 5lbz B: [342064]
   automated match to d4fgla_
   complexed with 6t3, fad, so4, zn

Details for d5lbzb_

PDB Entry: 5lbz, 1.4 Å

PDB Description: structure of the human quinone reductase 2 (nqo2) in complex with pacritinib

PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d5lbzb_:

Sequence; same for both SEQRES and ATOM records:

>d5lbzb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
kkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtlsnp
evfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlcq
gfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgfk
vlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg

Timeline for d5lbzb_:

• d5lbzb_ is new in SCOPe 2.06-stable
  
• d5lbzb_ appears in SCOPe 2.07
  
• d5lbzb_ appears in the current release, SCOPe 2.08