Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Goat (Capra hircus) [TaxId:9925] [341296] (4 PDB entries) |
Domain d5otba1: 5otb A:3-195 [341324] automated match to d3uiva1 complexed with peg, pge, pro |
PDB Entry: 5otb (more details), 2.5 Å
SCOPe Domain Sequences for d5otba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5otba1 a.126.1.0 (A:3-195) automated matches {Goat (Capra hircus) [TaxId: 9925]} hkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadeshagc dkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepdtl caefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpkie tmrekvlassarq
Timeline for d5otba1: