SCOP 1.59: Domain d1cqpb_: 1cqp B:

Lineage for d1cqpb_ (1cqp B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)

4. Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (6 PDB entries)

8. Domain d1cqpb_: 1cqp B: [34128]

Details for d1cqpb_

PDB Entry: 1cqp, 2.6 Å

PDB Description: crystal structure analysis of the complex lfa-1 (cd11a) i-domain / lovastatin at 2.6 a resolution

SCOP Domain Sequences for d1cqpb_:

Sequence; same for both SEQRES and ATOM records:

>d1cqpb_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi

Timeline for d1cqpb_:

• d1cqpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqpb_ appears in SCOP 1.57
  
• d1cqpb_ appears in SCOP 1.61
  
• d1cqpb_ appears in the current release, SCOPe 2.08