Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256134] (3 PDB entries) |
Domain d5o2da_: 5o2d A: [341272] automated match to d5cb5d_ complexed with 9hh |
PDB Entry: 5o2d (more details), 1.6 Å
SCOPe Domain Sequences for d5o2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o2da_ c.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} swekgslvspgglqmllvkegvqnaktdvvvnsvpldlvlsrgplsssllekagpelqee ldtvgqgvavsmgtvlktsswnldcryvlhvvapewrngstsslkimediirecmeites lslksiafpaigtgnlgfpknifaeliisevfsfsssnqlstlqevhfllhpsdheniqa fsdefarra
Timeline for d5o2da_: