Lineage for d1zopb_ (1zop B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125459Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 125460Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 125461Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 125477Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 125478Species Human (Homo sapiens) [TaxId:9606] [53303] (6 PDB entries)
  8. 125482Domain d1zopb_: 1zop B: [34125]

Details for d1zopb_

PDB Entry: 1zop (more details), 2 Å

PDB Description: cd11a i-domain with bound magnesium ion

SCOP Domain Sequences for d1zopb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zopb_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vie

SCOP Domain Coordinates for d1zopb_:

Click to download the PDB-style file with coordinates for d1zopb_.
(The format of our PDB-style files is described here.)

Timeline for d1zopb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zopa_