Lineage for d1zopb_ (1zop B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892271Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 2892272Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 2892287Domain d1zopb_: 1zop B: [34125]
    complexed with cl, mn

Details for d1zopb_

PDB Entry: 1zop (more details), 2 Å

PDB Description: cd11a i-domain with bound magnesium ion
PDB Compounds: (B:) I-domain fragment of lfa-1

SCOPe Domain Sequences for d1zopb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zopb_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vie

SCOPe Domain Coordinates for d1zopb_:

Click to download the PDB-style file with coordinates for d1zopb_.
(The format of our PDB-style files is described here.)

Timeline for d1zopb_: