Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Xanthomonas campestris [TaxId:190485] [232743] (6 PDB entries) |
Domain d3kzka2: 3kzk A:165-336 [340878] automated match to d3kzoa2 complexed with oln, so4 |
PDB Entry: 3kzk (more details), 1.9 Å
SCOPe Domain Sequences for d3kzka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kzka2 c.78.1.0 (A:165-336) automated matches {Xanthomonas campestris [TaxId: 190485]} tpdlrgkkyvltwtyhpkplntavansaltiatrmgmdvtllcptpdyilderymdwaaq nvaesggslqvshdidsayagadvvyakswgalpffgnwepekpirdqyqhfivderkma ltnngvfshclplrrnvkatdavmdspnciaideaenrlhvqkaimaalvgq
Timeline for d3kzka2: