SCOPe 2.07: Domain d3kzka1: 3kzk A:3-164

Lineage for d3kzka1 (3kzk A:3-164)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:190485] [232743] (6 PDB entries)

8. Domain d3kzka1: 3kzk A:3-164 [340877]
   automated match to d3kzoa1
   complexed with oln, so4

Details for d3kzka1

PDB Entry: 3kzk, 1.9 Å

PDB Description: crystal structure of acetylornithine transcarbamylase complexed with acetylcitrulline

PDB Compounds: (A:) N-acetylornithine carbamoyltransferase

SCOPe Domain Sequences for d3kzka1:

Sequence; same for both SEQRES and ATOM records:

>d3kzka1 c.78.1.0 (A:3-164) automated matches {Xanthomonas campestris [TaxId: 190485]}
lkhflntqdwsraeldalltqaalfkrnklgselkgksialvffnpsmrtrtsfelgafq
lgghavvlqpgkdawpiefnlgtvmdgdteehiaevarvlgryvdligvrafpkfvdwsk
dredqvlksfakyspvpvinmetithpcqelahalalqehfg

Timeline for d3kzka1:

• d3kzka1 first appeared in SCOPe 2.06
  
• d3kzka1 appears in the current release, SCOPe 2.08