Lineage for d5yhpa_ (5yhp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509699Species Glaciozyma antarctica [TaxId:105987] [340754] (1 PDB entry)
  8. 2509700Domain d5yhpa_: 5yhp A: [340775]
    automated match to d1azwa_
    complexed with flc

Details for d5yhpa_

PDB Entry: 5yhp (more details), 2.39 Å

PDB Description: proline iminopeptidase from psychrophilic yeast glaciozyma antarctica
PDB Compounds: (A:) Cold active proline iminopeptidase

SCOPe Domain Sequences for d5yhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yhpa_ c.69.1.0 (A:) automated matches {Glaciozyma antarctica [TaxId: 105987]}
tslfaaiqpykthllrvsplhrlsikeygnpqgkpvvflhggpgggasdsdarrfnptty
rivlfdqrgsgestpasclednttqalvediekireflqvgaawhvfggswgstlalaya
qahparvksltlrgiftlrkkeldffyqgpgssfvfpeyweeyldpipvaergdmvkayy
erltgsdekvraeagrawsrwematsrlhvdpdyiskadapgfadafarieshyfvnggf
mpegellkpeniakishipavivqgrydmvcpittayeltklwpeakfvvipdaghsaie
agtekalveateefakla

SCOPe Domain Coordinates for d5yhpa_:

Click to download the PDB-style file with coordinates for d5yhpa_.
(The format of our PDB-style files is described here.)

Timeline for d5yhpa_: