SCOPe 2.08: Domain d5yhpa_: 5yhp A:

Lineage for d5yhpa_ (5yhp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Glaciozyma antarctica [TaxId:105987] [340754] (1 PDB entry)

8. Domain d5yhpa_: 5yhp A: [340775]
   automated match to d1azwa_
   complexed with flc

Details for d5yhpa_

PDB Entry: 5yhp, 2.39 Å

PDB Description: proline iminopeptidase from psychrophilic yeast glaciozyma antarctica

PDB Compounds: (A:) Cold active proline iminopeptidase

SCOPe Domain Sequences for d5yhpa_:

Sequence; same for both SEQRES and ATOM records:

>d5yhpa_ c.69.1.0 (A:) automated matches {Glaciozyma antarctica [TaxId: 105987]}
tslfaaiqpykthllrvsplhrlsikeygnpqgkpvvflhggpgggasdsdarrfnptty
rivlfdqrgsgestpasclednttqalvediekireflqvgaawhvfggswgstlalaya
qahparvksltlrgiftlrkkeldffyqgpgssfvfpeyweeyldpipvaergdmvkayy
erltgsdekvraeagrawsrwematsrlhvdpdyiskadapgfadafarieshyfvnggf
mpegellkpeniakishipavivqgrydmvcpittayeltklwpeakfvvipdaghsaie
agtekalveateefakla

Timeline for d5yhpa_:

• d5yhpa_ first appeared in SCOPe 2.06
  
• d5yhpa_ appears in SCOPe 2.07