Lineage for d5wigb_ (5wig B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231748Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)
  8. 2231777Domain d5wigb_: 5wig B: [340319]
    automated match to d4u4la_
    complexed with zn

Details for d5wigb_

PDB Entry: 5wig (more details), 1.4 Å

PDB Description: structure of new delhi metallo-beta-lactamase 4 (ndm-4)
PDB Compounds: (B:) ndm-4

SCOPe Domain Sequences for d5wigb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wigb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5wigb_:

Click to download the PDB-style file with coordinates for d5wigb_.
(The format of our PDB-style files is described here.)

Timeline for d5wigb_: