Lineage for d2qdfa2 (2qdf A:92-174)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2243798Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132
  4. 2243799Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) (S)
    Pfam PF07244
  5. 2243800Family d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain [310646] (3 proteins)
  6. 2243804Protein YaeT [310792] (1 species)
  7. 2243805Species Escherichia coli K-12 [TaxId:83333] [311050] (2 PDB entries)
  8. 2243807Domain d2qdfa2: 2qdf A:92-174 [340298]
    Other proteins in same PDB: d2qdfa5
    automated match to d2qcza2
    complexed with mg

Details for d2qdfa2

PDB Entry: 2qdf (more details), 2.2 Å

PDB Description: structure of n-terminal domain of e. coli yaet
PDB Compounds: (A:) Outer membrane protein assembly factor yaeT

SCOPe Domain Sequences for d2qdfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qdfa2 d.391.1.1 (A:92-174) YaeT {Escherichia coli K-12 [TaxId: 83333]}
ptiasitfsgnksvkddmlkqnleasgvrvgesldrttiadiekgledfyysvgkysasv
kavvtplprnrvdlklvfqegvs

SCOPe Domain Coordinates for d2qdfa2:

Click to download the PDB-style file with coordinates for d2qdfa2.
(The format of our PDB-style files is described here.)

Timeline for d2qdfa2: