Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132 |
Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) Pfam PF07244 |
Family d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain [310646] (3 proteins) |
Protein YaeT [310792] (1 species) |
Species Escherichia coli K-12 [TaxId:83333] [311050] (2 PDB entries) |
Domain d2qdfa2: 2qdf A:92-174 [340298] Other proteins in same PDB: d2qdfa5 automated match to d2qcza2 complexed with mg |
PDB Entry: 2qdf (more details), 2.2 Å
SCOPe Domain Sequences for d2qdfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdfa2 d.391.1.1 (A:92-174) YaeT {Escherichia coli K-12 [TaxId: 83333]} ptiasitfsgnksvkddmlkqnleasgvrvgesldrttiadiekgledfyysvgkysasv kavvtplprnrvdlklvfqegvs
Timeline for d2qdfa2:
View in 3D Domains from same chain: (mouse over for more information) d2qdfa1, d2qdfa3, d2qdfa4, d2qdfa5 |