Lineage for d5y8ab1 (5y8a B:40-305)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2520116Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2520117Protein automated matches [190944] (40 species)
    not a true protein
  7. 2520135Species Burkholderia cenocepacia [TaxId:216591] [335925] (3 PDB entries)
  8. 2520139Domain d5y8ab1: 5y8a B:40-305 [340183]
    Other proteins in same PDB: d5y8aa2, d5y8ab2
    automated match to d2r7ab_
    complexed with ca, hem

Details for d5y8ab1

PDB Entry: 5y8a (more details), 2 Å

PDB Description: periplasmic heme-binding protein bhut in complex with two hemes (holo- 2 form)
PDB Compounds: (B:) Putative hemin transport system, substrate-binding protein

SCOPe Domain Sequences for d5y8ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y8ab1 c.92.2.0 (B:40-305) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
krviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsaegllsl
rpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrdagaall
qrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryagarnam
qgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrvvslda
lfllgfgprlplavttlhrrlsdala

SCOPe Domain Coordinates for d5y8ab1:

Click to download the PDB-style file with coordinates for d5y8ab1.
(The format of our PDB-style files is described here.)

Timeline for d5y8ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y8ab2