SCOPe 2.06: Domain d5miha_: 5mih A:

Lineage for d5miha_ (5mih A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
   a truncated form of this fold lacking one of the N-terminal strands
   automatically mapped to Pfam PF07828

6. Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82024] (19 PDB entries)

8. Domain d5miha_: 5mih A: [340027]
   automated match to d1okoa_
   complexed with 7nu, ca, ete

Details for d5miha_

PDB Entry: 5mih, 1.8 Å

PDB Description: crystal structure of the lectin leca from pseudomonas aeruginosa in complex with a phenyl-epoxy-galactopyranoside

PDB Compounds: (A:) PA-I galactophilic lectin

SCOPe Domain Sequences for d5miha_:

Sequence; same for both SEQRES and ATOM records:

>d5miha_ b.18.1.16 (A:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

Timeline for d5miha_:

• d5miha_ is new in SCOPe 2.06-stable
  
• d5miha_ appears in SCOPe 2.07
  
• d5miha_ appears in the current release, SCOPe 2.08