SCOPe 2.06: Domain d5ofzb_: 5ofz B:

Lineage for d5ofzb_ (5ofz B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Photorhabdus luminescens [TaxId:243265] [339829] (2 PDB entries)

8. Domain d5ofzb_: 5ofz B: [339839]
   automated match to d4ywaa_

Details for d5ofzb_

PDB Entry: 5ofz, 1.75 Å

PDB Description: plla lectin, apo

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5ofzb_:

Sequence; same for both SEQRES and ATOM records:

>d5ofzb_ b.18.1.0 (B:) automated matches {Photorhabdus luminescens [TaxId: 243265]}
dwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssia
tlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysplk

Timeline for d5ofzb_:

• d5ofzb_ is new in SCOPe 2.06-stable
  
• d5ofzb_ appears in SCOPe 2.07
  
• d5ofzb_ appears in the current release, SCOPe 2.08