SCOPe 2.06: Domain d5n8ta_: 5n8t A:

Lineage for d5n8ta_ (5n8t A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)

8. Domain d5n8ta_: 5n8t A: [339799]
   automated match to d2bc3b_
   complexed with dal, dgl, dgn, dhi, dle, dly, dth, dtr

Details for d5n8ta_

PDB Entry: 5n8t, 1.61 Å

PDB Description: crystal structure of streptavidin d-amino acid containing peptide gdlwqheatwkkq

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5n8ta_:

Sequence; same for both SEQRES and ATOM records:

>d5n8ta_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d5n8ta_:

• d5n8ta_ is new in SCOPe 2.06-stable
  
• d5n8ta_ appears in SCOPe 2.07
  
• d5n8ta_ appears in the current release, SCOPe 2.08