Lineage for d5jl4b_ (5jl4 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2493949Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2493955Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries)
  8. 2494012Domain d5jl4b_: 5jl4 B: [339782]
    automated match to d3vq9c_
    complexed with so4; mutant

Details for d5jl4b_

PDB Entry: 5jl4 (more details), 1.76 Å

PDB Description: inhibitor resistant mutant catalytic core domain of hiv-1 integrase
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d5jl4b_:

Sequence, based on SEQRES records: (download)

>d5jl4b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsntvkaacwwagikqefgipynpqsqgviesmnkelkkiigqirdqaehlkia
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d5jl4b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsntvkaacwwagikqefgviesmnkelkkiigqirdqaehlkiavqmavfihn
kkrkggiggysagerivdiiatdiq

SCOPe Domain Coordinates for d5jl4b_:

Click to download the PDB-style file with coordinates for d5jl4b_.
(The format of our PDB-style files is described here.)

Timeline for d5jl4b_: