SCOPe 2.06: Domain d5jl4b_: 5jl4 B:

Lineage for d5jl4b_ (5jl4 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (53 PDB entries)

8. Domain d5jl4b_: 5jl4 B: [339782]
   automated match to d3vq9c_
   complexed with so4; mutant

Details for d5jl4b_

PDB Entry: 5jl4, 1.76 Å

PDB Description: inhibitor resistant mutant catalytic core domain of hiv-1 integrase

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d5jl4b_:

Sequence, based on SEQRES records:

>d5jl4b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsntvkaacwwagikqefgipynpqsqgviesmnkelkkiigqirdqaehlkia
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d5jl4b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsntvkaacwwagikqefgviesmnkelkkiigqirdqaehlkiavqmavfihn
kkrkggiggysagerivdiiatdiq

Timeline for d5jl4b_:

• d5jl4b_ is new in SCOPe 2.06-stable
  
• d5jl4b_ appears in SCOPe 2.07
  
• d5jl4b_ appears in the current release, SCOPe 2.08