Lineage for d5w8uc2 (5w8u C:62-320)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534714Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2534715Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)
  7. 2534722Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311427] (5 PDB entries)
  8. 2534725Domain d5w8uc2: 5w8u C:62-320 [339682]
    Other proteins in same PDB: d5w8ua1, d5w8ub_, d5w8uc1, d5w8ud_
    automated match to d4pt5a2
    complexed with aye, mpd, zn

Details for d5w8uc2

PDB Entry: 5w8u (more details), 2.41 Å

PDB Description: crystal structure of mers-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (C:) ORF1ab protein

SCOPe Domain Sequences for d5w8uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w8uc2 d.3.1.23 (C:62-320) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssd

SCOPe Domain Coordinates for d5w8uc2:

Click to download the PDB-style file with coordinates for d5w8uc2.
(The format of our PDB-style files is described here.)

Timeline for d5w8uc2: