SCOPe 2.07: Domain d5w8uc1: 5w8u C:2-61

Lineage for d5w8uc1 (5w8u C:2-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (5 PDB entries)

8. Domain d5w8uc1: 5w8u C:2-61 [339681]
   Other proteins in same PDB: d5w8ua2, d5w8uc2
   automated match to d4pt5a1
   complexed with aye, mpd, zn

Details for d5w8uc1

PDB Entry: 5w8u, 2.41 Å

PDB Description: crystal structure of mers-cov papain-like protease in complex with the c-terminal domain of human isg15

PDB Compounds: (C:) ORF1ab protein

SCOPe Domain Sequences for d5w8uc1:

Sequence; same for both SEQRES and ATOM records:

>d5w8uc1 d.15.1.0 (C:2-61) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

Timeline for d5w8uc1:

• d5w8uc1 first appeared in SCOPe 2.06
  
• d5w8uc1 appears in the current release, SCOPe 2.08