SCOPe 2.02: Domain d1efkc2: 1efk C:21-279

Lineage for d1efkc2 (1efk C:21-279)

Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)
Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
Domain d1efkc2: 1efk C:21-279 [33949]
Other proteins in same PDB: d1efka1, d1efkb1, d1efkc1, d1efkd1
complexed with mak, mg, nad

Details for d1efkc2

PDB Entry: 1efk (more details), 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate

PDB Compounds: (C:) malic enzyme

SCOPe Domain Sequences for d1efkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efkc2 c.58.1.3 (C:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

SCOPe Domain Coordinates for d1efkc2:

Click to download the PDB-style file with coordinates for d1efkc2.
(The format of our PDB-style files is described here.)

Timeline for d1efkc2: