Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) |
Family c.58.1.3: Malic enzyme N-domain (Pfam 00390) [53240] (2 proteins) this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand |
Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries) |
Domain d1efld2: 1efl D:21-279 [33946] Other proteins in same PDB: d1efla1, d1eflb1, d1eflc1, d1efld1 |
PDB Entry: 1efl (more details), 2.6 Å
SCOP Domain Sequences for d1efld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efld2 c.58.1.3 (D:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)} ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh nafrflrkyrekyctfndd
Timeline for d1efld2: