Lineage for d1eflc1 (1efl C:280-573)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478576Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 478714Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 478732Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
  8. 478761Domain d1eflc1: 1efl C:280-573 [30297]
    Other proteins in same PDB: d1efla2, d1eflb2, d1eflc2, d1efld2

Details for d1eflc1

PDB Entry: 1efl (more details), 2.6 Å

PDB Description: human malic enzyme in a quaternary complex with nad, mg, and tartronate

SCOP Domain Sequences for d1eflc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eflc1 c.2.1.7 (C:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOP Domain Coordinates for d1eflc1:

Click to download the PDB-style file with coordinates for d1eflc1.
(The format of our PDB-style files is described here.)

Timeline for d1eflc1: