SCOPe 2.07: Domain d5tw2a1: 5tw2 A:7-185

Lineage for d5tw2a1 (5tw2 A:7-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d5tw2a1: 5tw2 A:7-185 [339315]
   Other proteins in same PDB: d5tw2a2, d5tw2b_
   automated match to d1zt4c2
   complexed with 7lp, fuc, nag, plm

Details for d5tw2a1

PDB Entry: 5tw2, 1.75 Å

PDB Description: structure of mouse cd1d with bound alpha-galactosylsphingamide jg168

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d5tw2a1:

Sequence, based on SEQRES records:

>d5tw2a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records):

>d5tw2a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypasesflhvafqgkyvvrf
wgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d5tw2a1:

• d5tw2a1 first appeared in SCOPe 2.06
  
• d5tw2a1 appears in the current release, SCOPe 2.08