Lineage for d5tw2a1 (5tw2 A:7-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 2507693Domain d5tw2a1: 5tw2 A:7-185 [339315]
    Other proteins in same PDB: d5tw2a2, d5tw2b_
    automated match to d1zt4c2
    complexed with 7lp, fuc, nag, plm

Details for d5tw2a1

PDB Entry: 5tw2 (more details), 1.75 Å

PDB Description: structure of mouse cd1d with bound alpha-galactosylsphingamide jg168
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d5tw2a1:

Sequence, based on SEQRES records: (download)

>d5tw2a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d5tw2a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypasesflhvafqgkyvvrf
wgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d5tw2a1:

Click to download the PDB-style file with coordinates for d5tw2a1.
(The format of our PDB-style files is described here.)

Timeline for d5tw2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tw2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5tw2b_