Lineage for d5nw2f_ (5nw2 F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378640Domain d5nw2f_: 5nw2 F: [339161]
    Other proteins in same PDB: d5nw2a_, d5nw2b1, d5nw2b2, d5nw2d_, d5nw2e1, d5nw2e2, d5nw2g_, d5nw2h1, d5nw2h2, d5nw2j_, d5nw2k1, d5nw2k2
    automated match to d1lqbc_
    complexed with 9b8

Details for d5nw2f_

PDB Entry: 5nw2 (more details), 2.2 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-3,3-dimethyl-2-(oxetane- 3-carboxamido)butanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl) pyrrolidine-2-carboxamide (ligand 19)
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nw2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw2f_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d5nw2f_:

Click to download the PDB-style file with coordinates for d5nw2f_.
(The format of our PDB-style files is described here.)

Timeline for d5nw2f_: