Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein Glutamate dehydrogenase [53225] (7 species) |
Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries) |
Domain d1hwxc2: 1hwx C:1-208 [33900] Other proteins in same PDB: d1hwxa1, d1hwxb1, d1hwxc1, d1hwxd1, d1hwxe1, d1hwxf1 |
PDB Entry: 1hwx (more details), 2.5 Å
SCOP Domain Sequences for d1hwxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwxc2 c.58.1.1 (C:1-208) Glutamate dehydrogenase {Cow (Bos taurus)} adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d1hwxc2: