SCOP 1.75: Domain d1hwxc2: 1hwx C:1-208

Lineage for d1hwxc2 (1hwx C:1-208)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)

8. Domain d1hwxc2: 1hwx C:1-208 [33900]
   Other proteins in same PDB: d1hwxa1, d1hwxb1, d1hwxc1, d1hwxd1, d1hwxe1, d1hwxf1

Details for d1hwxc2

PDB Entry: 1hwx, 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

PDB Compounds: (C:) glutamate dehydrogenase

SCOP Domain Sequences for d1hwxc2:

Sequence; same for both SEQRES and ATOM records:

>d1hwxc2 c.58.1.1 (C:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d1hwxc2:

• d1hwxc2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwxc2 appears in SCOP 1.73
  
• d1hwxc2 does not appear in SCOPe 2.01