Lineage for d5t6ea2 (5t6e A:263-492)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209910Species Neosartorya fumigata [TaxId:330879] [338948] (4 PDB entries)
  8. 2209918Domain d5t6ea2: 5t6e A:263-492 [338950]
    automated match to d1iica2
    complexed with 75r, mya

Details for d5t6ea2

PDB Entry: 5t6e (more details), 2.3 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a dichloro-dimethylpyridyl-methoxy- phenyl-pyridyl-piperazine ligand
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5t6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6ea2 d.108.1.0 (A:263-492) automated matches {Neosartorya fumigata [TaxId: 330879]}
yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr
ylsrfalnqaftreevdhwlvhkpetvkeqvvwayvvedpethkitdffsfynlestviq
npkhdnvraaylyyyatetaftnnmkalkerllmlmndalilakkahfdvfnaltlhdnp
lfleqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml

SCOPe Domain Coordinates for d5t6ea2:

Click to download the PDB-style file with coordinates for d5t6ea2.
(The format of our PDB-style files is described here.)

Timeline for d5t6ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5t6ea1