Lineage for d1b3bc2 (1b3b C:4-178)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246933Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 246934Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 246935Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 246936Protein Glutamate dehydrogenase [53225] (7 species)
  7. 246988Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries)
  8. 247003Domain d1b3bc2: 1b3b C:4-178 [33894]
    Other proteins in same PDB: d1b3ba1, d1b3bb1, d1b3bc1, d1b3bd1, d1b3be1, d1b3bf1

Details for d1b3bc2

PDB Entry: 1b3b (more details), 3.1 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k

SCOP Domain Sequences for d1b3bc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3bc2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel

SCOP Domain Coordinates for d1b3bc2:

Click to download the PDB-style file with coordinates for d1b3bc2.
(The format of our PDB-style files is described here.)

Timeline for d1b3bc2: