Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.6: omega toxin-like [57059] (5 families) |
Family g.3.6.2: Spider toxins [57072] (26 proteins) |
Protein automated matches [254476] (8 species) not a true protein |
Species Haplopelma schmidti [TaxId:29017] [255481] (3 PDB entries) |
Domain d5t3ma_: 5t3m A: [338654] automated match to d2mpqa_ mutant |
PDB Entry: 5t3m (more details)
SCOPe Domain Sequences for d5t3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t3ma_ g.3.6.2 (A:) automated matches {Haplopelma schmidti [TaxId: 29017]} gclgifkacnpsndqcckssklvcsrktrwckwqi
Timeline for d5t3ma_: