Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) |
Family e.18.1.0: automated matches [191637] (1 protein) not a true family |
Protein automated matches [191173] (9 species) not a true protein |
Species Methanothermococcus thermolithotrophicus [TaxId:523845] [338595] (5 PDB entries) |
Domain d5odqf_: 5odq F: [338606] automated match to d3ze7b_ complexed with 9s8, 9sb, act, fad, fe, fes, gol, nfu, pe3, sf4, trs |
PDB Entry: 5odq (more details), 2.15 Å
SCOPe Domain Sequences for d5odqf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5odqf_ e.18.1.0 (F:) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]} vklsvepvtrveghgkisvsfddsgnldkvrfhvvevrgfekflegryvedapiytpric gicqvahhlasakavdnvfgvkipetaellrnlmhqgatvhshalhfymlaapdlmfptt ddvlkrnlmgiakehpeiikdaielrkagqnvvrvvggraihpvtavvggqskslkeeer dellklsertielseksievgkkllenikdedlldigyfesahmgmvnngvhdlydgklr vvnsegkveyefdpseymnyiaegvkpysylkfpylkdkgeedgiyrvntlsrlnvsdkm atplaqkyydefvkefgkpchhpmlfhyarliellssaemvkellendkivgediraepe evvgdgvgcveaprgtlihhfktdddgiitdtnlvvatvqnnpamdigvrkvaekyikap edatpqvlnymemliraydpclscath
Timeline for d5odqf_: