Lineage for d6aqgb1 (6aqg B:9-153)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.0: automated matches [191416] (1 protein)
not a true familyProtein automated matches [190576] (50 species)
not a true protein
Species Mycobacterium ulcerans [TaxId:362242] [334392] (2 PDB entries) 
Domain d6aqgb1: 6aqg B:9-153 [338470]
Other proteins in same PDB: d6aqga2, d6aqgb2, d6aqgc2, d6aqgd2
automated match to d3bjua1
protein/RNA complex; complexed with krs, lys, mpd
Details for d6aqgb1
PDB Entry: 6aqg (more details), 2.25 Å
PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium ulcerans complexed with l-lysine and cladosporin
PDB Compounds: (B:) Lysine--tRNA ligaseSCOPe Domain Sequences for d6aqgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqgb1 b.40.4.0 (B:9-153) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
peqfrirrdkrarllaegydpypvaierthtlaeiratyadlptdsatedivgvagrvvf
arntgklcfatlqdgdgtqlqamisldevgresldrwkadvdigdvvyvhgtvissrrge
lsvladswrmaakalrplpvahkem
SCOPe Domain Coordinates for d6aqgb1:
Click to download the PDB-style file with coordinates for d6aqgb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6aqgb1:
View in 3D
