Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Mycobacterium ulcerans [TaxId:362242] [334392] (2 PDB entries) |
Domain d6aqgb1: 6aqg B:9-153 [338470] Other proteins in same PDB: d6aqga2, d6aqgb2, d6aqgc2, d6aqgd2 automated match to d3bjua1 protein/RNA complex; complexed with krs, lys, mpd |
PDB Entry: 6aqg (more details), 2.25 Å
SCOPe Domain Sequences for d6aqgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aqgb1 b.40.4.0 (B:9-153) automated matches {Mycobacterium ulcerans [TaxId: 362242]} peqfrirrdkrarllaegydpypvaierthtlaeiratyadlptdsatedivgvagrvvf arntgklcfatlqdgdgtqlqamisldevgresldrwkadvdigdvvyvhgtvissrrge lsvladswrmaakalrplpvahkem
Timeline for d6aqgb1: