Lineage for d5h2fh_ (5h2f H:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254818Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2254819Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2254820Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2254821Species Thermosynechococcus elongatus [TaxId:146786] [161028] (4 PDB entries)
    Uniprot Q8DJ43 2-65
  8. 2254822Domain d5h2fh_: 5h2f H: [338461]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d4pj0h_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fh_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5h2fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d5h2fh_:

Click to download the PDB-style file with coordinates for d5h2fh_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fh_: