Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (18 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries) |
Domain d5vw5a2: 5vw5 A:157-316 [338338] Other proteins in same PDB: d5vw5a1 automated match to d3lo8a2 complexed with fad, mg, nca; mutant |
PDB Entry: 5vw5 (more details), 1.95 Å
SCOPe Domain Sequences for d5vw5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vw5a2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]} mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd eeftsylkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhveva
Timeline for d5vw5a2: