Lineage for d5ni4c2 (5ni4 C:209-460)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206010Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2206026Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 2206027Species Human (Homo sapiens) [TaxId:9606] [64340] (56 PDB entries)
    Uniprot P09960
  8. 2206078Domain d5ni4c2: 5ni4 C:209-460 [338221]
    Other proteins in same PDB: d5ni4a1, d5ni4a3, d5ni4b1, d5ni4b3, d5ni4c1, d5ni4c3
    automated match to d3u9wa2
    complexed with dj3, imd, zn; mutant

Details for d5ni4c2

PDB Entry: 5ni4 (more details), 1.9 Å

PDB Description: crystal structure of human lta4h mutant e271a in complex with lta4 (crystal form ii)
PDB Compounds: (C:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5ni4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ni4c2 d.92.1.13 (C:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmanpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d5ni4c2:

Click to download the PDB-style file with coordinates for d5ni4c2.
(The format of our PDB-style files is described here.)

Timeline for d5ni4c2: