Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64340] (56 PDB entries) Uniprot P09960 |
Domain d5ni4c2: 5ni4 C:209-460 [338221] Other proteins in same PDB: d5ni4a1, d5ni4a3, d5ni4b1, d5ni4b3, d5ni4c1, d5ni4c3 automated match to d3u9wa2 complexed with dj3, imd, zn; mutant |
PDB Entry: 5ni4 (more details), 1.9 Å
SCOPe Domain Sequences for d5ni4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ni4c2 d.92.1.13 (C:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmanpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d5ni4c2: