![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
![]() | Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries) |
![]() | Domain d5waui_: 5wau I: [337818] Other proteins in same PDB: d5waua_, d5waub1, d5waub2, d5wauc_, d5waud_, d5waue_, d5wauf_, d5waug_, d5wauh_, d5wauj_, d5wauk_, d5waul_, d5waum_ automated match to d1v54i_ complexed with cdl, chd, cmo, cu, cua, dmu, fme, hea, mg, na, pek, pgv, psc, sac, tgl, zn |
PDB Entry: 5wau (more details), 1.95 Å
SCOPe Domain Sequences for d5waui_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5waui_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} talakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfe emrkagifqsak
Timeline for d5waui_: