Lineage for d5ww7a_ (5ww7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991845Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries)
  8. 1991903Domain d5ww7a_: 5ww7 A: [337722]
    automated match to d2z90a_
    complexed with cl, fe, fe2, mg

Details for d5ww7a_

PDB Entry: 5ww7 (more details), 2.05 Å

PDB Description: crystal structure of the second dna-binding protein under starvation from mycobacterium smegmatis soaked with iron in the ratio of 360 iron atoms per dodecamer
PDB Compounds: (A:) Putative starvation-induced DNA protecting protein/Ferritin and Dps

SCOPe Domain Sequences for d5ww7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ww7a_ a.25.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msarrtesdiqgfhatpefggnlqkvlvdlielslqgkqahwnvvgsnfrdlhlqldelv
dfaregsdtiaermraldavpdgrsdtvaatttlpefpaferstadvvdlittrinatvd
tirrvhdavdaedpstadllhglidglekqawlirsenrkv

SCOPe Domain Coordinates for d5ww7a_:

Click to download the PDB-style file with coordinates for d5ww7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ww7a_: