| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) ![]() |
| Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
| Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries) Uniprot P16455 6-176 |
| Domain d1eh7a2: 1eh7 A:5-91 [33750] Other proteins in same PDB: d1eh7a1 complexed with zn |
PDB Entry: 1eh7 (more details), 2 Å
SCOPe Domain Sequences for d1eh7a2:
Sequence, based on SEQRES records: (download)
>d1eh7a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq
>d1eh7a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgvpapaavlggpeplmqctawlnayfhqpe
aieefpvpalhhpvfqq
Timeline for d1eh7a2: