Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) |
Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
Protein DNA repair protein MutS, domain II [53152] (2 species) |
Species Thermus aquaticus [TaxId:271] [53153] (3 PDB entries) |
Domain d1ewqb3: 1ewq B:1121-1266 [33741] Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa4, d1ewqb1, d1ewqb2, d1ewqb4 CASP4 complexed with edo, so4 |
PDB Entry: 1ewq (more details), 2.2 Å
SCOP Domain Sequences for d1ewqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewqb3 c.55.6.1 (B:1121-1266) DNA repair protein MutS, domain II {Thermus aquaticus} llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp frfydpgafmrlpeatlralevfepl
Timeline for d1ewqb3:
View in 3D Domains from other chains: (mouse over for more information) d1ewqa1, d1ewqa2, d1ewqa3, d1ewqa4 |