SCOP 1.57: Domain d3bdpa1: 3bdp A:297-468

Lineage for d3bdpa1 (3bdp A:297-468)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries)

8. Domain d3bdpa1: 3bdp A:297-468 [33711]
   Other proteins in same PDB: d3bdpa2

Details for d3bdpa1

PDB Entry: 3bdp, 1.9 Å

PDB Description: dna polymerase i/dna complex

SCOP Domain Sequences for d3bdpa1:

Sequence; same for both SEQRES and ATOM records:

>d3bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d3bdpa1:

• d3bdpa1 first appeared (with stable ids) in SCOP 1.55
  
• d3bdpa1 appears in SCOP 1.59
  
• d3bdpa1 appears in the current release, SCOPe 2.08