Lineage for d3bdpa1 (3bdp A:297-468)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries) 
Domain d3bdpa1: 3bdp A:297-468 [33711]
Other proteins in same PDB: d3bdpa2
Details for d3bdpa1
PDB Entry: 3bdp (more details), 1.9 Å
PDB Description: dna polymerase i/dna complex
SCOP Domain Sequences for d3bdpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
SCOP Domain Coordinates for d3bdpa1:
Click to download the PDB-style file with coordinates for d3bdpa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bdpa1:
- d3bdpa1 appears in SCOP 1.57
- d3bdpa1 appears in the current release, SCOPe 2.08
View in 3D
