Lineage for d2bdpa1 (2bdp A:297-468)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124680Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 124703Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 124704Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries)
  8. 124706Domain d2bdpa1: 2bdp A:297-468 [33709]
    Other proteins in same PDB: d2bdpa2

Details for d2bdpa1

PDB Entry: 2bdp (more details), 1.8 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna

SCOP Domain Sequences for d2bdpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d2bdpa1:

Click to download the PDB-style file with coordinates for d2bdpa1.
(The format of our PDB-style files is described here.)

Timeline for d2bdpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bdpa2