Lineage for d5obcb_ (5obc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928150Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)
  8. 2928402Domain d5obcb_: 5obc B: [337034]
    automated match to d1kf3a_
    complexed with 9q8, po4, ru2

Details for d5obcb_

PDB Entry: 5obc (more details), 2.07 Å

PDB Description: x-ray structure of the adduct formed upon reaction of ribonuclease a with the compound fac-[ruii(co)3cl2(n3-im), im=imidazole
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d5obcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obcb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d5obcb_:

Click to download the PDB-style file with coordinates for d5obcb_.
(The format of our PDB-style files is described here.)

Timeline for d5obcb_: