Lineage for d5ohgi2 (5ohg I:141-431)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2098970Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2099072Protein automated matches [226973] (6 species)
    not a true protein
  7. 2099080Species Escherichia coli [TaxId:83333] [337032] (1 PDB entry)
  8. 2099084Domain d5ohgi2: 5ohg I:141-431 [337033]
    Other proteins in same PDB: d5ohga1, d5ohgb1, d5ohgh1, d5ohgi1
    automated match to d2fymc1
    complexed with mg, na, po4

Details for d5ohgi2

PDB Entry: 5ohg (more details), 2 Å

PDB Description: enolase in complex with rnase e
PDB Compounds: (I:) enolase

SCOPe Domain Sequences for d5ohgi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ohgi2 c.1.11.1 (I:141-431) automated matches {Escherichia coli [TaxId: 83333]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

SCOPe Domain Coordinates for d5ohgi2:

Click to download the PDB-style file with coordinates for d5ohgi2.
(The format of our PDB-style files is described here.)

Timeline for d5ohgi2: