SCOP 1.59: Domain d1cmwa3: 1cmw A:290-422

Lineage for d1cmwa3 (1cmw A:290-422)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)

7. Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)

8. Domain d1cmwa3: 1cmw A:290-422 [33701]
   Other proteins in same PDB: d1cmwa1, d1cmwa2, d1cmwa4

Details for d1cmwa3

PDB Entry: 1cmw, 2.6 Å

PDB Description: crystal structure of taq dna-polymerase shows a new orientation for the structure-specific nuclease domain

SCOP Domain Sequences for d1cmwa3:

Sequence, based on SEQRES records:

>d1cmwa3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

Sequence, based on observed residues (ATOM records):

>d1cmwa3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearg
llakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalse
rlfanlwgrleg

Timeline for d1cmwa3:

• d1cmwa3 first appeared (with stable ids) in SCOP 1.55
  
• d1cmwa3 appears in SCOP 1.57
  
• d1cmwa3 appears in SCOP 1.61
  
• d1cmwa3 last appears in SCOP 1.75